Protein Info for PFR28_03413 in Pseudomonas sp. RS175

Annotation: Holliday junction ATP-dependent DNA helicase RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF01330: RuvA_N" amino acids 1 to 62 (62 residues), 86 bits, see alignment E=4.4e-28 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 200 (200 residues), 201.9 bits, see alignment E=3.5e-64 PF14520: HHH_5" amino acids 72 to 130 (59 residues), 61.3 bits, see alignment E=3.1e-20 PF07499: RuvA_C" amino acids 158 to 201 (44 residues), 60.8 bits, see alignment 4.2e-20

Best Hits

Swiss-Prot: 95% identical to RUVA_PSEPF: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 98% identity to pba:PSEBR_a4441)

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>PFR28_03413 Holliday junction ATP-dependent DNA helicase RuvA (Pseudomonas sp. RS175)
MIGRLRGTLAEKQPPHLILDVNGLGYELEVPMTTLYRLPSVGEPLTLHTHLVVREDAQLL
YGFVGKRERDFFRELIRLNGVGPKLALALMSSLEVDELIRCVQSQDTSALTKVPGVGKKT
AERLLVELKDRFKAWETVPAMFALVPNQPDAPMPAASAENDAVTALISLGYKPQEASKAI
SAIKEKGLSTEDMIRRALKGMI