Protein Info for PFR28_03411 in Pseudomonas sp. RS175

Annotation: Acyl-CoA thioester hydrolase YbgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02799: tol-pal system-associated acyl-CoA thioesterase
  • amino acids 10 to 135 (126 residues), 157.6 bits, E=1.8e-50
• TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family
  • amino acids 13 to 130 (118 residues), 108.7 bits, E=2.2e-35
• PF13279: 4HBT_2
  • amino acids 19 to 137 (119 residues), 59.1 bits, E=5.9e-20
• PF03061: 4HBT
  • amino acids 24 to 105 (82 residues), 51.5 bits, E=1e-17

Best Hits

KEGG orthology group: K01075, 4-hydroxybenzoyl-CoA thioesterase [EC: 3.1.2.23] (inferred from 97% identity to pba:PSEBR_a4439)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

MetaCyc Pathways

• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• 4-chlorobenzoate degradation (2/4 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.23

Protein Sequence (155 amino acids)

>PFR28_03411 Acyl-CoA thioester hydrolase YbgC (Pseudomonas sp. RS175)
MRAQNGLESFAHRCRVYYEDTDAGGIVYYVNYLKFMERARTERLRELGFAQSALAGEDLL
FVVHSSEARYNAPARLDDELLVSADVIELYRASLRFKQQVRRATDNALLCEGQFLVACVR
THSLKPRAIPEALRAAFAGVSGAGTHSEQEIKRGS