Protein Info for PFR28_03403 in Pseudomonas sp. RS175

Annotation: 7-cyano-7-deazaguanine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF06508: QueC" amino acids 11 to 221 (211 residues), 277.8 bits, see alignment E=5.3e-87 TIGR00364: queuosine biosynthesis protein QueC" amino acids 12 to 214 (203 residues), 212 bits, see alignment E=3.3e-67 PF00733: Asn_synthase" amino acids 14 to 68 (55 residues), 36.1 bits, see alignment E=6.1e-13

Best Hits

Swiss-Prot: 92% identical to QUEC1_PSEF5: 7-cyano-7-deazaguanine synthase 1 (queC1) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 96% identity to pba:PSEBR_a4432)

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>PFR28_03403 7-cyano-7-deazaguanine synthase (Pseudomonas sp. RS175)
MTEQSNTVEKRAVILLSGGLDSATVVAMARAEGYRCYTMSFDYGQRHRAELLAAERVARD
LGVVEHKVIGLNLNGIGGSALTDSSIDVPEAPSEGIPVTYVPARNTVFLSLALGWAEVLG
ARDIFIGVNAVDYSGYPDCRPEFVEAFERMANLATKAGVEGQGFRIQAPLQNLSKAQIVQ
AGVKLGVDYGLTVSCYQADDQGRACGKCDSCRLRAEGFAAAGVSDPTPYF