Protein Info for PFR28_03392 in Pseudomonas sp. RS175

Annotation: Copper resistance protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 75 (30 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF05425: CopD" amino acids 194 to 300 (107 residues), 79.5 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 58% identical to COPD_PSESF: Copper resistance protein D (copD) from Pseudomonas syringae pv. actinidiae

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 76% identity to pba:PSEBR_a4429)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>PFR28_03392 Copper resistance protein D (Pseudomonas sp. RS175)
MSDSINLELINIALRLALYLDLMLLFGLAAFGLYGLRGRERRSGEVLPFAGFLATTALVG
VLLSMAGMLCMAWSMSGVSDWAELRPHVEMMVLETDVGTSWSLRVLALILATVAATQSKR
WPTASLWLVTLAAGAAVATLAWAGHGAMDEGERRTWHLITDFLHLWAAGAWVGALAAFVL
LLRQAEHRLSVLARTLTGFETAGAVIVLVISMTGAVNYLFIVGPTLDILPDSLYGQLMAL
KLGLFMAMLTFAALNRFHLSPLLEQARQTGEHRVAVNALRRSMALELSVAVIILGLVAWL
GTLSPGIDA