Protein Info for PFR28_03389 in Pseudomonas sp. RS175

Annotation: Copper resistance protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 2 to 616 (615 residues), 992.6 bits, see alignment E=6.3e-303 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 5 to 32 (28 residues), 21.5 bits, see alignment (E = 2.2e-08) PF07732: Cu-oxidase_3" amino acids 53 to 163 (111 residues), 133.8 bits, see alignment E=5e-43 amino acids 507 to 615 (109 residues), 29.3 bits, see alignment E=1.2e-10 PF00394: Cu-oxidase" amino acids 172 to 345 (174 residues), 87.5 bits, see alignment E=1.7e-28 PF07731: Cu-oxidase_2" amino acids 500 to 616 (117 residues), 99.9 bits, see alignment E=1.6e-32

Best Hits

Swiss-Prot: 76% identical to COPA_PSEUB: Copper resistance protein A (copA) from Pseudomonas syringae pv. tomato

KEGG orthology group: None (inferred from 79% identity to ppf:Pput_0574)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (617 amino acids)

>PFR28_03389 Copper resistance protein A (Pseudomonas sp. RS175)
MQTNTSRRTFVKGLTAGGILGGLGLWRAPVWALTGPDQPNVLSGTEFDLFIGESPVNFTG
HPRTAQTINGGIPGPLLRWREGDTVTLRVRNRLKDTTSIHWHGIILPANMDGVPGLSFKG
IEPDGQYVYQFKVRQNGTYWYHSHSGFQEQSGVYGPLVIDAREPEPFQYERDYVVMLSDW
TDEDPADVIRKLKKQSDYYNYNKRTVGDFIDDVASKGWGATVADRKMWAEMKMNPTDLAD
VSGATYTYLMNGQAPDMNWTGLFKPGERIRLRLINGSSMTYFDVRIPGLKMTVVASDGQY
VNPVQVDEFRIAVAETYDVIIEPTEQAYTLFAQSMDRTGYARGTLAARPGLAAPVPPLDP
RPLVTMDDMGMGGMDHGSMGDMGAMDHGSMQGMDHSQMPAMDHGSMQGMDHSQMPAMDHG
SMQGMDHSEMPMMDHGAMPGMGDMPTHPASEKDNPLVDMQAMSVKPKLDDPGMGLRNNGR
RVLTYADLRSTFPDPDGREPGRTIELHLTGHMEKFVWSFNGVKFSDAAPLLFKYGERLRI
VLVNDTMMTHPIHLHGMWSDLEDEDGQFMVRKHTLDVPPGSRRSYRVTADALGRWAYHCH
LLFHMEMGMFREIRVQE