Protein Info for PFR28_03388 in Pseudomonas sp. RS175

Annotation: Quinolinate synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 30 to 341 (312 residues), 361.7 bits, E=1.5e-112
• PF02445: NadA
  • amino acids 34 to 339 (306 residues), 348.5 bits, E=1.5e-108

Best Hits

Swiss-Prot: 97% identical to NADA_PSEPF: Quinolinate synthase A (nadA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 99% identity to pba:PSEBR_a4425)

MetaCyc: 67% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Protein Sequence (352 amino acids)

>PFR28_03388 Quinolinate synthase A (Pseudomonas sp. RS175)
MTQISERLLVQAHLDAKQPKPLSAEQEAWYRAAIAAELKAQDAVLVAHFYCDPIIQALAE
ETGGCVSDSLEMARFGNAHPAKTVVVAGVKFMGETAKILNPEKRVLMPTLEATCSLDLGC
PVEEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIVESLMDNGETIIWGPDK
HLGTYIQRKTGADMLLWDGACIVHEEFKSKQLEDMKALYPDAAILVHPESPTSVIELADA
VGSTSQLIAAAQSLPNKTLIVATDRGIFYKMQQLCPDKVFIEAPTAGNGAACRSCAHCPW
MAMNTLERTLKSLQEGTNEIFVDPALIPQAIRPLKRMLDFTQAARMKLAGNA