Protein Info for PFR28_03376 in Pseudomonas sp. RS175

Annotation: C4-dicarboxylate transport transcriptional regulatory protein DctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF00072: Response_reg" amino acids 7 to 115 (109 residues), 94.1 bits, see alignment E=1.5e-30 PF00158: Sigma54_activat" amino acids 146 to 312 (167 residues), 235 bits, see alignment E=9.7e-74 PF14532: Sigma54_activ_2" amino acids 147 to 317 (171 residues), 81.2 bits, see alignment E=2.2e-26 PF07728: AAA_5" amino acids 169 to 287 (119 residues), 25.8 bits, see alignment E=2.4e-09 PF02954: HTH_8" amino acids 397 to 437 (41 residues), 38.5 bits, see alignment 1.9e-13

Best Hits

Swiss-Prot: 57% identical to DCTD_PSEAE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 97% identity to pba:PSEBR_a4413)

Predicted SEED Role

"Two component, Sigma-54 Specific, central transcriptional regulator of acidic amino acid uptake"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>PFR28_03376 C4-dicarboxylate transport transcriptional regulatory protein DctD (Pseudomonas sp. RS175)
MNNDLSVLIVEDDPHVLLGCQQALALEDIPCIGVGSAEEALERVGDDFAGIVISDIRLPG
IDGLELLTRLKARDRSLPVVLITGHGDISMAVGAMQKGAYDFMEKPFSPERLVDVARRAL
EQRSLAREVSSLRRQLAERDSLEGRIIGRSPAMQHLRELIANVADTSANVLIEGETGTGK
ELVARCLHDFSRRHDKQFVALNCGGLPENLFESEIFGHEANAFTGAGKRRIGKIEHADGG
TLFLDEVESMPLPLQIKLLRVLQERTLERLGSNQSVAVDCRVIAATKSDLDEMGRAGQFR
SDLYYRLNVVTLELPPLRERREDILQLFEHFLQQSSLRFDRTPPELDNQTLSNLMSHDWP
GNVRELRNVAERFALGLPAFKKPGASGGQGLAFAEAVEAFERNLLADALQRSGGNLTQAS
QELGMAKTTLFDKVKKYGLSH