Protein Info for PFR28_03373 in Pseudomonas sp. RS175

Annotation: Glutamate/aspartate import permease protein GltK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 117 (105 residues), 82 bits, see alignment E=1.9e-27 PF00528: BPD_transp_1" amino acids 34 to 222 (189 residues), 77.7 bits, see alignment E=5e-26

Best Hits

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 97% identity to pba:PSEBR_a4410)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>PFR28_03373 Glutamate/aspartate import permease protein GltK (Pseudomonas sp. RS175)
MMEFDFTGIVPAIPGLWNGMVMTLKLMALGVVGGIVLGTILALMRLSHNKLVSNIAGTYV
NYFRSIPLLLVITWFYLAVPFVLRWITGEDTPIGAFGSCVVAFMMFEAAYFCEIVRAGVQ
SIPKGQMGAAQALGMNYGQTMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFL
NASRASGDIIGRSNEFLIIAGLVYFTISFAASLLVKRLQKRFAV