Protein Info for PFR28_03359 in Pseudomonas sp. RS175
Annotation: Bacterioferritin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 85% identical to BFR_AZOVI: Bacterioferritin (bfr) from Azotobacter vinelandii
KEGG orthology group: K03594, bacterioferritin (inferred from 97% identity to pfo:Pfl01_4523)MetaCyc: 64% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]
Predicted SEED Role
"Bacterioferritin" in subsystem Iron acquisition in Vibrio
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.16.3.1
Use Curated BLAST to search for 1.16.3.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (157 amino acids)
>PFR28_03359 Bacterioferritin (Pseudomonas sp. RS175) MKGDITVIQHLNKILANELVAINQYFLHARMYEDWGLNKLGKHEYHESIDEMKHADKLIK RILFLEGLPNVQDLGKLHIGEHTREMLECDLRIERTGHADLKAAIAHCESVGDFGSRELL EDILESEEEHIDWLETQLGLIDKVGLENYLQSQMGDE