Protein Info for PFR28_03344 in Pseudomonas sp. RS175

Annotation: Ion-translocating oxidoreductase complex subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 6 to 187 (182 residues), 55.1 bits, see alignment E=4.9e-19

Best Hits

KEGG orthology group: K03617, electron transport complex protein RnfA (inferred from 80% identity to pba:PSEBR_a4381)

Predicted SEED Role

"Electron transport complex protein RnfA" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>PFR28_03344 Ion-translocating oxidoreductase complex subunit A (Pseudomonas sp. RS175)
MSDVFLTLLGTALISNLVLHWPLGVDPMLAVDGRRQVHALGLASACLMLVVGTLGYLVDR
WLLVPASLTSLRLFAWLPLSVLLIGPLLRLLATWLPAWSFEGLWPLLLGNAGILGVTLLN
SQADQGLVHAIALSLGAGLGFWLVSSLFDDLRRRTVDNDIPQPFRGLPIQLIGAGLMAVA
FLGLRGLVKT