Protein Info for PFR28_03325 in Pseudomonas sp. RS175

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details PF00672: HAMP" amino acids 168 to 221 (54 residues), 30.4 bits, see alignment 5.8e-11 PF00512: HisKA" amino acids 227 to 289 (63 residues), 47.5 bits, see alignment E=2.3e-16 PF02518: HATPase_c" amino acids 335 to 438 (104 residues), 75.2 bits, see alignment E=8.3e-25

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a4362)

Predicted SEED Role

"Putative two-component system sensor kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>PFR28_03325 Adaptive-response sensory-kinase SasA (Pseudomonas sp. RS175)
MRSLFWRILASFWLAITLVAGLSILMGHMLNQDAWILSRHPGLNTLAEEWTQTYESQGED
AAQGILQQRKRQYHIDVQVLNESGDPVVRGTFPHRAAAFEARQNNDDRRLPWRRLTDEFT
SSKTGDTYLFIYRIPHPELDAWHRGSLLWPLSALGIALVVLTLFSLLVTLSITRPLSRLR
GAVHDLGQTTYQQNSLAKLANRRDEFGVLATDFNRMGARLQSLIGSQRQLLRDVSHELRS
PLARLRIALALAERAAPQERENLWPRLTRECDRLEALISEILVLARVDADNASAEEVDLD
GLLVALQKDAQLASPEQTVQLDIEPNLTLKGWPTMIERAVDNLLRNAQRFNPPGQPIEMR
AVRQGERILISVRDHGPGVEAEHLGQLGEPFYRAPGQTAAGHGLGLAIARRAAERHGGAL
VLANHPEGGFIASLELPLVPGAVVQP