Protein Info for PFR28_03316 in Pseudomonas sp. RS175

Annotation: Segregation and condensation protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00281: segregation and condensation protein B
  • amino acids 9 to 176 (168 residues), 105.8 bits, E=1e-34
• PF04079: SMC_ScpB
  • amino acids 13 to 172 (160 residues), 163.9 bits, E=1.2e-52

Best Hits

KEGG orthology group: K06024, segregation and condensation protein B (inferred from 89% identity to pba:PSEBR_a4354)

Predicted SEED Role

"Segregation and condensation protein B" in subsystem Two cell division clusters relating to chromosome partitioning

Protein Sequence (311 amino acids)

>PFR28_03316 Segregation and condensation protein B (Pseudomonas sp. RS175)
MNLTEPRELAPLLEAFLLASGKPQSMERLFELFEEGERPEPAVFKKALALLGKSCEGRAF
ELKEVASGYRLQIREKFAPWVGRLWEERPQRYSRAMLETMALIAYRQPITRGEIEDVRGV
AVNSHIVKTLLEREWIRVVGYRDVPGKPAMFATTKAFLDHFNLKNLDELPPLAELRELEP
EPVLEFDDAPVPPGLQELADASAEPEEPREETSFHSLLLELDTMEEGLKTDFDDLLRDGP
PVTEEEAPGIESEPQAEPEQDILGVAEAREKLLAAVAALEPREPEPELSEEEAEARALAE
AIENERRQLDD