Protein Info for PFR28_03294 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 6 to 11 (6 residues), see Phobius details transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details PF01925: TauE" amino acids 7 to 266 (260 residues), 127.2 bits, see alignment E=4.2e-41

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 74% identity to pba:PSEBR_a4334)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>PFR28_03294 hypothetical protein (Pseudomonas sp. RS175)
MSYLLLACFGCLSGVTAVLFGFGGGFVVVPLIYRWLMARHANDAIGESAMHIAVATSTCV
MIVNALVATRKHQRAGQLLAHYLWPFGAFIALGAALGAMTATWMSGEIIRYVFSAYLALT
ILDCLLRRGFLTRQSYVVPRSLSTLETTLGGTAVGIIATFLGVGGSVMTVPLLRRCGLSM
SQATSMANPLSLPVALAGTVTYMALAGLTGADLGPWFVGYVDLLAFAVLTLGAVLGIRLA
MPWVGRIPDRLHARVYVGLLMVVMGAMLSG