Protein Info for PFR28_03273 in Pseudomonas sp. RS175

Annotation: Aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 1 to 405 (405 residues), 434.6 bits, E=3.8e-134
• PF00696: AA_kinase
  • amino acids 3 to 231 (229 residues), 178 bits, E=4e-56
• TIGR00657: aspartate kinase
  • amino acids 65 to 404 (340 residues), 399.6 bits, E=2.1e-123
• PF01842: ACT
  • amino acids 269 to 326 (58 residues), 41.8 bits, E=1.1e-14
• PF13840: ACT_7
  • amino acids 341 to 400 (60 residues), 56.6 bits, E=2.9e-19

Best Hits

Swiss-Prot: 95% identical to AK_PSEFS: Aspartate kinase (PFLU_4747) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 98% identity to pba:PSEBR_a4309)

MetaCyc: 70% identical to aspartokinase (Halomonas elongata DSM 2581)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• spermidine biosynthesis II (3/4 steps found)
• norspermidine biosynthesis (4/6 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• ectoine biosynthesis (3/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of polyamine biosynthesis III (5/8 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Protein Sequence (413 amino acids)

>PFR28_03273 Aspartate kinase (Pseudomonas sp. RS175)
MALIVQKFGGTSVGTVERIEQVADKVKKFREAGDDLVVVLSAMSGETNRLIDLAKQISGD
QQPVPRELDVIVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHNKARILQIDD
QKIRGDLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGV
YTTDPRVVPVAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKEGPGT
LITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANIEVDMIVQNV
SHDNTTDFTFTVHRNDYQAAEAVLKKTASEIGAREVVGDTKIAKVSIVGVGMRSHAGVAS
RMFESLAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAAARQGE