Protein Info for PFR28_03208 in Pseudomonas sp. RS175

Annotation: Cobyrinate a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01656: CbiA
  • amino acids 10 to 187 (178 residues), 48.6 bits, E=8e-17
• PF07685: GATase_3
  • amino acids 239 to 419 (181 residues), 112.8 bits, E=1.7e-36

Best Hits

Swiss-Prot: 74% identical to COBB_PSEU5: Hydrogenobyrinate a,c-diamide synthase (cobB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 92% identity to pba:PSEBR_a4244)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Protein Sequence (455 amino acids)

>PFR28_03208 Cobyrinate a,c-diamide synthase (Pseudomonas sp. RS175)
MHSRQCPAVLIAAPASGQGKTTVTAALARLHRTQGRRVRVFKCGPDFLDPMILERASGAP
VYQLDMWMVGEQESRRLLWEAAGEADLILIEGVMGLFDGTPSSADLARHFGVPVLAVIDG
TAMAQTFGALALGLARYQADLPFAGVLANRVGTLRHAQLLEGSLTEGLRWYGALSRETGI
ELPSRHLGLVQASELNDLDLRLDAAAEALASSCEVTLPPAVTFAAPEVVAVQPWLDGVRI
AVARDEAFAFTYGASLDLLRAMGAQLSFFSPIHDTTLPEADSLYLPGGYPELHHVALARN
ASMLAAIRAHHEAGKPLLAECGGMLYLLDSLTDVEGTRAELLGLLAGEAQMQKRLAALAL
QAVELPEGTLRGHTYHHSLTSTDVAPIARGQSPNGGRGAEAVFRQGRMTASYVHFYFPSN
PRAIAALFAPVPEAAFANTFDHLTPVEAGLLAKRP