Protein Info for PFR28_03206 in Pseudomonas sp. RS175

Annotation: Cobalamin biosynthesis protein CobD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 53 to 88 (36 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details TIGR00380: cobalamin biosynthesis protein CobD" amino acids 8 to 268 (261 residues), 194.4 bits, see alignment E=1.4e-61 PF03186: CobD_Cbib" amino acids 8 to 282 (275 residues), 319.7 bits, see alignment E=1.6e-99 PF17113: AmpE" amino acids 126 to 222 (97 residues), 23.9 bits, see alignment E=2.7e-09

Best Hits

Swiss-Prot: 76% identical to COBD_PSEAE: Cobalamin biosynthesis protein CobD (cobD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 95% identity to pba:PSEBR_a4242)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>PFR28_03206 Cobalamin biosynthesis protein CobD (Pseudomonas sp. RS175)
MSVALLSAAAVALDALLGEPRRWHPLVAFGGFADRIEQRFNAGGRGWRSHGVTAWFIAVV
PLTLLATALSWAPLVGWLVDILALYCALGLRSLGEHVEPVARALRSGDLDEARQRVGYLV
SRETRELDETAVARAATESVLENGSDAVFAALFWFAVAGAPGVVLYRLSNTLDAMWGYRN
ERFERFGWAAARIDDGLNYIPARLVALTYALLGKTRVALRCWRRQGPTWDSPNAGPVMAA
GAGALGVELGGAAVYHGELHQRPPLGEGVPASADSIDRGWQLVQRGVWLWLLILCLGAEF
YA