Protein Info for PFR28_03145 in Pseudomonas sp. RS175

Annotation: allantoicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02961: allantoicase
  • amino acids 11 to 328 (318 residues), 473.3 bits, E=1.4e-146
• PF03561: Allantoicase
  • amino acids 20 to 165 (146 residues), 169 bits, E=3.3e-54
  • amino acids 187 to 329 (143 residues), 167.1 bits, E=1.3e-53

Best Hits

Swiss-Prot: 94% identical to ALLC_PSEPF: Probable allantoicase (alc) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01477, allantoicase [EC: 3.5.3.4] (inferred from 97% identity to pba:PSEBR_a4186)

Predicted SEED Role

"Allantoicase (EC 3.5.3.4)" in subsystem Allantoin Utilization (EC 3.5.3.4)

MetaCyc Pathways

• superpathway of purines degradation in plants (14/18 steps found)
• superpathway of allantoin degradation in yeast (5/6 steps found)
• allantoin degradation to glyoxylate I (2/3 steps found)
• allantoin degradation to ureidoglycolate I (urea producing) (1/2 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.4

Protein Sequence (333 amino acids)

>PFR28_03145 allantoicase (Pseudomonas sp. RS175)
MKAYAVPFEKFVNLADARLGTRIISVTDDWFADANRLFQPTPAVWKEGVFDDNGKWMDGW
ESRRKRFEGYDSAVIRLGVPGSIKGVDIDTSFFTGNYPPSASLEACFLAEGDPDENTQWT
EVLAAVELKGDSHHYHEIANDQAFSHLRFNIYPDGGVARLRVHGIPYRDWSAVGDNEQVD
LAAALNGGRALACSDEHFGRMSNILNPGRGVNMGDGWETARRRTPGNDWVIVALGHAGIV
EKVIVDTLHFKGNYPDSCSIQGAFVKGGTDSQIETQSLFWRELLPSQKLEMHAEHTFAEQ
IKALGPITHIRLNVFPDGGVSRLRVLGKVSKQG