Protein Info for PFR28_03144 in Pseudomonas sp. RS175

Annotation: Uric acid degradation bifunctional protein PucL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF09349: OHCU_decarbox" amino acids 11 to 168 (158 residues), 171.9 bits, see alignment E=7.6e-55 TIGR03164: OHCU decarboxylase" amino acids 12 to 169 (158 residues), 230.8 bits, see alignment E=3.9e-73

Best Hits

Swiss-Prot: 42% identical to URAD_HALVD: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (HVO_B0301) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a4185)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>PFR28_03144 Uric acid degradation bifunctional protein PucL (Pseudomonas sp. RS175)
MTVFQTLKPSTMGREAFVRAFADIYEHSPWVAEKAFDLGQDPSIDEIETLHQRMSDILLS
ADHASQLALINAHPDLAGKAAVQGQLTEASTNEQAGAGIHQCTAEEFQRFTELNEAYKAK
FRFPFIMAVKGSNRHQILAAFETRIHNPVDTEFQCALAEINKIALFRLLTL