Protein Info for PFR28_03125 in Pseudomonas sp. RS175

Annotation: putative 3-phenylpropionic acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 267 to 283 (17 residues), see Phobius details amino acids 288 to 314 (27 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details PF12832: MFS_1_like" amino acids 6 to 359 (354 residues), 372.4 bits, see alignment E=3.9e-115 PF03825: Nuc_H_symport" amino acids 8 to 374 (367 residues), 55.3 bits, see alignment E=8.8e-19 PF07690: MFS_1" amino acids 12 to 247 (236 residues), 39.6 bits, see alignment E=4.7e-14 amino acids 222 to 380 (159 residues), 53.2 bits, see alignment E=3.4e-18

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 95% identity to pba:PSEBR_a4170)

Predicted SEED Role

"Nucleoside:H+ symporter:Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>PFR28_03125 putative 3-phenylpropionic acid transporter (Pseudomonas sp. RS175)
MAALPYWRLSSFYLFYFALLGSTAPFLALYFDHLGFNAARIGELVAIPMLMRCVAPNIWG
WLGDYTGQRLAIVRFGAICTLLTFSLIFIDKSYAWLAMVMALHAFFWHAVLPQFEVITLA
HLGGQASRYSQVRLWGSIGFIIAVVALGRLLEWLSLDIYPVALVLIMGGIVFASFWVPNA
QPVQGPRVAGDGFLRQLRNPGVLAFYACVGLMQVSHGPYYTFLTLHLEHLGYSRGLIGVL
WAVGVVAEVLMFLLMSRILARFSVRRVLLASFLLAALRWLLLGSLAEFLWVLLFAQVLHA
ATFGSFHAAAIHFVQRSFGPRQQGQGQALYAALAGTGGALGALYSGYSWNALGASWTFNI
ASLAAFAAAVLIAIRMKEDRP