Protein Info for PFR28_03108 in Pseudomonas sp. RS175

Annotation: HTH-type transcriptional regulator RutR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00440: TetR_N" amino acids 25 to 71 (47 residues), 60.9 bits, see alignment 8e-21 PF08362: TetR_C_3" amino acids 72 to 213 (142 residues), 211 bits, see alignment E=6.8e-67

Best Hits

Swiss-Prot: 40% identical to RUTR_ECOL6: HTH-type transcriptional regulator RutR (rutR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4152)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>PFR28_03108 HTH-type transcriptional regulator RutR (Pseudomonas sp. RS175)
MRNRQNRQGTPGFMSTIRERNKELILRAASEEFADKGFAATKTSDIAAKAGLPKPNVYYY
FKSKENLYREVLESIIEPILQASTPFNADGVPGEVLSHYIRSKIRISRDLPFASKVFASE
IMHGAPHLSPDLVEQLNAQARHNIECIQTWIDRGQIAPVDPNHLMFSIWAATQTYADFDW
QISAVTGKAKLDETDYEAAAQTIIRLVLKGCEPDR