Protein Info for PFR28_03107 in Pseudomonas sp. RS175

Annotation: Inner membrane protein YedI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 75 to 100 (26 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 270 to 296 (27 residues), see Phobius details PF05661: DUF808" amino acids 4 to 289 (286 residues), 383.9 bits, see alignment E=2.5e-119

Best Hits

Swiss-Prot: 62% identical to YEDI_ECOLI: Inner membrane protein YedI (yedI) from Escherichia coli (strain K12)

KEGG orthology group: K09781, hypothetical protein (inferred from 95% identity to pba:PSEBR_a4151)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>PFR28_03107 Inner membrane protein YedI (Pseudomonas sp. RS175)
MAGSSLLVLIDDIATVLDDVALMTKMAAKKTAGVLGDDLALNAQQVSGVRAERELPVVWA
VAKGSFINKLILVPSALAISAFVPWLVTPLLMVGGAYLCFEGFEKLAHKFLHSPAEDQAE
HEQLVEAVADPAVDLVAFEKDKIKGAVRTDFILSAEIIAITLGTVADAPLTQQVIVLSGI
AIVMTVGVYGLVAGIVKLDDLGLWLTQKPGQAAKSIGGAILSAAPYMMKSLSVIGTAAMF
LVGGGILTHGVPVVHHWIEGVATSAGGAGFIVPMLLNAVAGIVAGAAVLAGVMVVGKVWK
ALKG