Protein Info for PFR28_03073 in Pseudomonas sp. RS175

Annotation: Putative esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 21 to 136 (116 residues), 132.4 bits, E=4.2e-43
• PF03061: 4HBT
  • amino acids 51 to 128 (78 residues), 70.9 bits, E=4.6e-24

Best Hits

Swiss-Prot: 79% identical to Y1618_PSEAE: Putative esterase PA1618 (PA1618) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a4116)

MetaCyc: 53% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

"FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein"

MetaCyc Pathways

• superpathway of chorismate metabolism (43/59 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (1/7 steps found)
• superpathway of menaquinol-8 biosynthesis I (3/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (2/9 steps found)
• superpathway of menaquinol-10 biosynthesis (2/10 steps found)
• superpathway of menaquinol-11 biosynthesis (2/10 steps found)
• superpathway of menaquinol-12 biosynthesis (2/10 steps found)
• superpathway of menaquinol-13 biosynthesis (2/10 steps found)
• superpathway of menaquinol-6 biosynthesis (2/10 steps found)
• superpathway of menaquinol-7 biosynthesis (2/10 steps found)
• superpathway of menaquinol-9 biosynthesis (2/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (1/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (1/9 steps found)
• superpathway of phylloquinol biosynthesis (2/15 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.28

Protein Sequence (147 amino acids)

>PFR28_03073 Putative esterase (Pseudomonas sp. RS175)
MSLWRNTPNIEQLNAAGKNTISEMLDIRFESFDDESLTASMVVDHRTHQPFGLLHGGASV
VLAETVGSMAAYLCVDTSKFYCVGLEINANHLRGVRSGRVTATARMIHLGRTTQVWDIRL
TDDNGKLNCVSRLTMAVVPLGEQPPSR