Protein Info for PFR28_03033 in Pseudomonas sp. RS175

Annotation: Inner membrane transport permease YadH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 108 to 134 (27 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details PF01061: ABC2_membrane" amino acids 12 to 221 (210 residues), 137.9 bits, see alignment E=3.4e-44 PF12698: ABC2_membrane_3" amino acids 61 to 245 (185 residues), 45.4 bits, see alignment E=6.2e-16

Best Hits

Swiss-Prot: 60% identical to YADH_ECO57: Inner membrane transport permease YadH (yadH) from Escherichia coli O157:H7

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 98% identity to pba:PSEBR_a4073)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>PFR28_03033 Inner membrane transport permease YadH (Pseudomonas sp. RS175)
MSSEFRPNLIALNTIVYREVRRFMRIWPQTLLPPAITMVLYFVIFGNLIGRQIGDMGGFT
YMDYIVPGLIMMSVITNSYGNVVSSFFGSKFQRSIEELMVSPVSPHTILIGFTLGGVLRG
LAVGLIVTLLSLFFTDLQVHHLGVTILVVVLTATIFSLLGFINAVFARNFDDISIIPTFV
LTPLTYLGGVFYSISLLPPFWQTVSLANPVLHMVNAFRYGILGVSDIRISIAITFMLVAT
VVLYIGCARLLVSGRGMRT