Protein Info for PFR28_02996 in Pseudomonas sp. RS175

Annotation: 6-deoxy-6-sulfogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08450: SGL
  • amino acids 12 to 261 (250 residues), 237.3 bits, E=1e-74

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a4037)

Predicted SEED Role

"L-arabinolactonase (EC 3.1.1.15)" in subsystem L-Arabinose utilization (EC 3.1.1.15)

MetaCyc Pathways

• L-arabinose degradation III (5/6 steps found)
• L-arabinose degradation IV (6/8 steps found)
• L-arabinose degradation V (3/6 steps found)
• superpathway of pentose and pentitol degradation (14/42 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.15

Protein Sequence (290 amino acids)

>PFR28_02996 6-deoxy-6-sulfogluconolactonase (Pseudomonas sp. RS175)
MWKAVTEHRAKLGEGPFWDEPTQALYWVDIAGRQALRLIGANVQIWQMPEHVSAFIPTQR
GDALVTLSSGVYRLDLESPGLEPRLTLLCMADPQPGNRANEARCDALGRLWLGTMQNNIG
EDGEDLPIERRSGGLFRVGGDGRVMPLLRGLGIPNTLLWSPDGTTVYFGESLDGTLYRHF
IYPDGSLAPAEVWFGPHSRGGPDGSAMDARGYIWNARWDGSCLLRLSPQGHIDRVIELPV
SRPTSCVFGGEDLKTLYITSAASPLGHPLDGAVLSMRVDVPGIPCTRFAG