Protein Info for PFR28_02935 in Pseudomonas sp. RS175

Annotation: Phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 19 to 236 (218 residues), 172.4 bits, E=1.2e-54
• PF01507: PAPS_reduct
  • amino acids 34 to 211 (178 residues), 185.6 bits, E=4.1e-59
• TIGR02055: adenylylsulfate reductase, thioredoxin dependent
  • amino acids 40 to 235 (196 residues), 284.7 bits, E=3.7e-89

Best Hits

Swiss-Prot: 86% identical to CYSH_PSEA8: Phosphoadenosine phosphosulfate reductase (cysH) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 98% identity to pba:PSEBR_a3965)

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8

Protein Sequence (246 amino acids)

>PFR28_02935 Phosphoadenosine phosphosulfate reductase (Pseudomonas sp. RS175)
MSPSFDVVELATTYANKSPQDILKLAFAEFGDDLWISFSGAEDVVLVDMAWKLNKNVKVF
SLDTGRLHPETYRFIDQVREHYKIDIEVISPDHTKLEPFVKEKGLFSFYKDGHGECCGIR
KIEPLRRKLADVRAWATGQRRDQSPGTRSQVAVLEIDTAFSTPERTLYKFNPLSQMTSEE
VWGYIRMLELPYNSLHERGFISIGCEPCTRPVLPNQHEREGRWWWEEATQKECGLHAGNI
ISKSKA