Protein Info for PFR28_02873 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 90% identity to pba:PSEBR_a3911)

MetaCyc: 66% identical to ferribactin monooxygenase monomer (Pseudomonas aeruginosa PAO1)
1.14.18.-

Predicted SEED Role

"Pyoverdine biosynthesis related protein PvdP" in subsystem Siderophore Pyoverdine

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (538 amino acids)

>PFR28_02873 hypothetical protein (Pseudomonas sp. RS175)
MTISRRWFMAGLALTGAAVPAVYYGHRELTRPDPTITPGEASFDVADVAGQRRADKLRGI
WTIRFTGRDAGLDGLPPEGLQVFLDIAHKGRGLVGCLDTAERLRAGDEPRYRLLGDLAGA
DPRQLSWRLTGAEHAAPDYEFIMTLDEVWAGFGNAGRATLSGRVSRLDRSAALPELDNQF
IALKQAFPEARERTPLSPALLAWLVSPEHRLFHQLWHASRDKWHALDEDKRDALRGLGWQ
PGPRDQERDARGPRKDRNGSGIDFFFMHRHMLGTARSFQPLPSWQRFPLPQPELDRDRLG
FARYFDNLDGTALPPTWLAAGDEQYAQWVSDIKTAETYHSNFLVWESRYRDPRYLSKLTL
GQFGSEVELGLHDWLHMRWASVPRDPSNGHPVPFARDQADFAQRWFAPENDFLGDPFSSH
VNPVFWAFHGWIDDRIEDWFRAHERFHPGEVSRLEVKGVPWFAPGRWVEIADPWLGPDTH
GCSTTPGLQVGRSVEMDPETMKLALRITFGSDDKKLSKLLRRVPQRPWYARNLKARPV