Protein Info for PFR28_02867 in Pseudomonas sp. RS175

Annotation: putative RNA polymerase sigma factor FecI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF07638: Sigma70_ECF" amino acids 2 to 144 (143 residues), 30.2 bits, see alignment E=8.5e-11 PF04542: Sigma70_r2" amino acids 2 to 65 (64 residues), 40 bits, see alignment E=5.4e-14 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 2 to 150 (149 residues), 78.2 bits, see alignment E=2.8e-26 PF08281: Sigma70_r4_2" amino acids 97 to 149 (53 residues), 63.4 bits, see alignment E=2.4e-21 PF04545: Sigma70_r4" amino acids 102 to 150 (49 residues), 33.8 bits, see alignment E=4e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 98% identity to pba:PSEBR_a3907)

Predicted SEED Role

"Sigma-70 factor FpvI (ECF subfamily), controling pyoverdin biosynthesis" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>PFR28_02867 putative RNA polymerase sigma factor FecI (Pseudomonas sp. RS175)
MENYYRELVCFLNARLGNRQAAEDVVHDAYVRVLERASDTPIEQPRAFLYRTALNLVIDG
HRRNTLRQVESLDVLDSEERFFTPSPHTSLDHGQRLDMLQRALAELPPLCRESFLLRKLE
GLSHPQIAERLGISRALVEKHIVNAMKHCRIRVRQWDKG