Protein Info for PFR28_02861 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 153 to 219 (67 residues), 66.8 bits, see alignment E=1.5e-22 PF00027: cNMP_binding" amino acids 352 to 435 (84 residues), 57.2 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: None (inferred from 88% identity to pba:PSEBR_a3901)

Predicted SEED Role

"Mechanosensitive ion channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>PFR28_02861 hypothetical protein (Pseudomonas sp. RS175)
MLSLITDHPMLCALVLLVLDLLLWRLVSTQRTYWKIGGRLVIFSLFSMLLFNEGLNPMVP
APWGDDVPRHLAATGLQIAWWLFAARTLTVMIGAAMMQRVGHTGRLLQDLLGAVIFLIAV
IAALAYVLDLPVKGVLATSGAMAIIVGLALQSTLSDVFSGIVLNTTKPYQLDDWISIDGT
EGRVTDIDWRATRLQTAQGSMAVIPNSLAAKAKIVNFSRPSDVHGLSISVPVSPHARPQK
VIEALERAMIGCRALLSSPAPCVTLKSTGSAGAEYEISGFVASMSQKREVRNQLFDLAFR
HLRASGISLLSTSENTAAAGTSRPRALLDSSSIFATLRPEEKDTFSQNMTLQTFRAGDMI
LPAGEVSDHLFIIESGVVSVTLVRNGQVLEGGRMGPGEVIGEAGIVSDQAALANFTAKTF
CSLYRIEKSYLKPCLDARHDIADAMKNLLDVRTHLAQNLTREMPKPVAKKRFLQWLRSRA