Protein Info for PFR28_02820 in Pseudomonas sp. RS175

Annotation: Aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01745: aspartate-semialdehyde dehydrogenase
  • amino acids 2 to 368 (367 residues), 651.2 bits, E=2.1e-200
• PF01118: Semialdhyde_dh
  • amino acids 3 to 121 (119 residues), 90 bits, E=1.6e-29
• PF02774: Semialdhyde_dhC
  • amino acids 144 to 354 (211 residues), 180.3 bits, E=4.5e-57

Best Hits

Swiss-Prot: 90% identical to DHAS_PSEAE: Aspartate-semialdehyde dehydrogenase (asd) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 100% identity to pba:PSEBR_a3864)

MetaCyc: 70% identical to aspartate-beta-semialdehyde dehydrogenase subunit (Vibrio cholerae)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• spermidine biosynthesis II (3/4 steps found)
• norspermidine biosynthesis (4/6 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• ectoine biosynthesis (3/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of polyamine biosynthesis III (5/8 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.11

Use Curated BLAST to search for 1.2.1.11

Protein Sequence (370 amino acids)

>PFR28_02820 Aspartate-semialdehyde dehydrogenase (Pseudomonas sp. RS175)
MKRVGLIGWRGMVGSVLMQRMLEEQDFDLIEPVFFTTSNVGGQGPSVGKDTGALKDAYSI
EELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMQDDAVIILDPVNRKVID
QQLDAGTKNYIGGNCTVSLMLMGLGGLFEAGLVEWMSAMTYQAASGAGAQNMRELIKQMG
ATHAAVADDLANPASAILDIDRKVAEAMRSDAYPTENFGVPLAGSLIPWIDKELPNGQSR
EEWKAQAETNKILGRFKSPIPVDGICVRIGAMRCHSQALTIKLNKDVPIADIEGLISQHN
PWVKLVPNNREASMQELSPTKVTGTLNVPVGRLRKLNMGSQFVGAFTVGDQLLWGAAEPL
RRMLRILLER