Protein Info for PFR28_02770 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 55 to 79 (25 residues), see Phobius details PF02397: Bac_transf" amino acids 54 to 241 (188 residues), 203.5 bits, see alignment E=1e-64

Best Hits

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_a3749)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>PFR28_02770 hypothetical protein (Pseudomonas sp. RS175)
MTRHEQHIPINVPGDKRVDPEHRQRLDAAIHRQGRGWLTGRHGGRPWTVSRTNRVVACLG
ALVLLVLLSPLLLGLAVLVKVSSPGPVLFVQKRTGYRGRVFGMYKFRTMIANAEALKESL
RHLNKHGADAIDFKIDNDPRITPIGRFLRRSSLDELPNLINVVTGDMRLVGPRPTSFNAY
RYKDNHLARLSIYPGLTGLWQISGRSDIDFDQRVELDLSYIAEQSLLLDLKILMITPFKV
FSGHGAS