Protein Info for PFR28_02750 in Pseudomonas sp. RS175

Annotation: Multiple antibiotic resistance protein MarR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF12802: MarR_2" amino acids 22 to 80 (59 residues), 53 bits, see alignment E=4.6e-18 PF01047: MarR" amino acids 23 to 81 (59 residues), 58.3 bits, see alignment E=8.4e-20 PF13463: HTH_27" amino acids 30 to 89 (60 residues), 33.4 bits, see alignment E=6.7e-12

Best Hits

Swiss-Prot: 41% identical to MARR_ECOLI: Multiple antibiotic resistance protein MarR (marR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a3725)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>PFR28_02750 Multiple antibiotic resistance protein MarR (Pseudomonas sp. RS175)
MLLGRAALLKDRIIDTHMEPVGITAAQFKVLIIMAQHGIDTPAELCRYLSLDSGSMTRML
DRLEQKGFLVRHRSAQDRRQVQLVLTDAGQALADRLPYIGADAMNQLAGAISREELQTLE
QILKKILLAAGDPITVLRLGDK