Protein Info for PFR28_02737 in Pseudomonas sp. RS175

Annotation: Ribose import binding protein RbsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 35 to 300 (266 residues), 99.4 bits, see alignment E=4.1e-32 PF13407: Peripla_BP_4" amino acids 37 to 300 (264 residues), 199.4 bits, see alignment E=1.2e-62 PF13377: Peripla_BP_3" amino acids 170 to 264 (95 residues), 35.2 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 96% identity to pba:PSEBR_a3711)

Predicted SEED Role

"Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>PFR28_02737 Ribose import binding protein RbsB (Pseudomonas sp. RS175)
MKLPFAGRLLAVAMLATASATLPFSSAFAQTTEKPKVALVMKSLANEFFLTMEDGAKAYQ
KEHSADFDLISNGIKDETDTANQIRIVEQMIVSKVDALIIAPADSKAMVPVIKKAVDAGI
TVVNIDNQLDPDVVKSKNITVPFVGPDNRKGARLVGEYLAKQLKAGDEVGIIEGVSTTTN
AQARTAGFKDAMEAAQIKVVSLQSGDWEINKGNQVAASMLSEYPNIKALLAGNDSMAVGA
VSAVRAAGKAGKVQVVGYDNINAIKPMLKDGRVLATADQFAARQAVFGIETALKILKKEK
VESGANGVIETPVELVTK