Protein Info for PFR28_02606 in Pseudomonas sp. RS175

Annotation: Replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF05496: RuvB_N" amino acids 17 to 142 (126 residues), 52.2 bits, see alignment E=1.8e-17 PF00004: AAA" amino acids 50 to 158 (109 residues), 61.9 bits, see alignment E=2.8e-20 PF07728: AAA_5" amino acids 50 to 140 (91 residues), 28.6 bits, see alignment E=4e-10 PF16193: AAA_assoc_2" amino acids 184 to 260 (77 residues), 75.8 bits, see alignment E=8e-25 PF12002: MgsA_C" amino acids 261 to 427 (167 residues), 220.8 bits, see alignment E=3.1e-69

Best Hits

Swiss-Prot: 61% identical to RARA_ECOL6: Replication-associated recombination protein A (rarA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07478, putative ATPase (inferred from 98% identity to pba:PSEBR_a3561)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>PFR28_02606 Replication-associated recombination protein A (Pseudomonas sp. RS175)
MDLFRSAPIAQPLAARLRATNLDEYVGQEHVLARGKPLREALEQGALHSMIFWGPPGVGK
TTLARLLAEVSDAHFETVSAVLAGVKEIRQAVEVAKQQAGQYGKRTILFVDEVHRFNKSQ
QDAFLPYVEDGTLIFIGATTENPSFELNNALLSRARVYVLKSLDEAAMRKLVQRALTEER
GLGKRRLSLSDEGFQMLVSAADGDGRRLLNLLENASDLAEDDSEIGVELLQSLLGDTRRR
FDKGGEAFYDQISALHKSIRGSNPDAALYWFARMIDGGCDPLYLARRVVRMASEDIGNAD
PRALSLCLAAWDVQERLGSPEGELAVAQAITYLACAPKSNAVYMGFKTAMRSATEHGSLE
VPLHLRNAPTKLMKQLGYGEEYRYAHDEPDAYAAGEDYFPEELEPQSFYQPVPRGLELKI
GEKLNHLAQLDRSSPRQRRKP