Protein Info for PFR28_02578 in Pseudomonas sp. RS175

Annotation: Glycolate permease GlcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 117 to 148 (32 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 398 to 422 (25 residues), see Phobius details amino acids 434 to 452 (19 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details amino acids 551 to 575 (25 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 5 to 575 (571 residues), 519.5 bits, see alignment E=5.5e-160 PF02652: Lactate_perm" amino acids 15 to 572 (558 residues), 517.8 bits, see alignment E=1.8e-159

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 96% identity to pba:PSEBR_a3531)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (587 amino acids)

>PFR28_02578 Glycolate permease GlcA (Pseudomonas sp. RS175)
MVWQQVYDPFGNAVLSTILAAVPVVVMLASLAFFHIKAHLAALYALASALLIAIFAFGMP
ADMAGSAALYGAANGLLPIGWIVLNIIFLHRLTTENGSFKVLQDSLARITDDRRLQLLLI
AFCFGAFFEGAAGFGTPVAVTGAILIGLGFSPLAASGLALIANTAPVAFGALGTPIITLA
KVTGLDEMELSMMVGRQLPFFSVIVPFWLIWAFAGWRKMLEVWPAILVAGVSFAIPQFLV
SNYHGPMLVDVIAALISMACLTGFLKVWKPATVHTSAALSGRHDDSKIDASEQQQPAASG
AFASDTRPAVLRAWMPWIILTVFVFAWGTQGFKNLFDTRPAIDPQTQSVRLDPQGKPMRE
ANPVFSPLLTFGTIHQQIEKVPPVVPQPKTEEAVYKFNWFTATGSGIFLAAILGGLLMGY
SIPQLVRQYLRTLWVVRYSLITIVAMLALGFLTRYSGLDATMGLAFAATGIFYPMFGTLL
GWLGVALTGSDTASNVLFGGLQRVTAEQLGISPVLMAAANSSGGVMGKMVDAQSIVVAST
ATRWYGHEGEILRYVFFHSVVLAILVGGLVTLQAYVEPFSHMVVGGR