Protein Info for PFR28_02563 in Pseudomonas sp. RS175

Annotation: Divalent metal cation transporter MntH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details PF01566: Nramp" amino acids 44 to 405 (362 residues), 160.9 bits, see alignment E=2.4e-51

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a3517)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>PFR28_02563 Divalent metal cation transporter MntH (Pseudomonas sp. RS175)
MTSIPTVEGQAAASTQSRFVRILKLLGPGIIAVLSWLGAGDLITSSVAGANYGYAMMWVL
AVSLLLRYLIVNIIARFQLCNNQGMTILQGYAQLNPFFAWFLLVYALLMGHLMNAYMIKG
AGESLAMLLKVDYPLACSMAVVLAVWLLVGRNIYSMIEGVMKALLAIMTLAFIALAVMSG
PDVAGIVRGTIGFSIPPDEGVHGALLVAVSVIGAVAGSIANFVHPYVMRQKGWTGPEHKR
IQRNDLLFAVFVGIVINLAIWIVGAEILRPNGIEVKTLGDLGKALELFFGPIGWYVFFVG
VFATLFASISGKTTAFPMLITDAFQHVRPERRERYGKEFHRDPMHKWFMLFILVTPLIWS
FPGMPDFVTLTIGVSALNIIGLPVISLGLLIMSNQKSLLGKEYRNNLFENIALAFATGLA
LWVAFQLGVDLFT