Protein Info for PFR28_02517 in Pseudomonas sp. RS175

Annotation: Protein-glutamate methylesterase/protein-glutamine glutaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00072: Response_reg" amino acids 7 to 110 (104 residues), 73.6 bits, see alignment E=1.5e-24 PF01339: CheB_methylest" amino acids 176 to 354 (179 residues), 218.3 bits, see alignment E=6.4e-69

Best Hits

Swiss-Prot: 87% identical to CHEB1_PSEU2: Protein-glutamate methylesterase/protein-glutamine glutaminase 1 (cheB1) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 96% identity to pba:PSEBR_a3446)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>PFR28_02517 Protein-glutamate methylesterase/protein-glutamine glutaminase (Pseudomonas sp. RS175)
MSKKINVLLVDDSAVVRQVMLAILSETPDIHVMGAASDPIFAMDKLAREWPDVIVLDVEM
PRMDGITFLKKIMSERPTPVVICSSLTPTGAETTAQAMAAGAVEIITKPTSGLKNFLLES
ASELVTAIRAAAQVNVRNLGRRPAPAPLVPAAKLSADAMLPAANGHAMAQTTERIVALGT
STGGTQALEAVLTALPRVCPGIVIVQHMPEKFTASFAARLNSLCQIEVREARNNDRIHPG
LALIAPGGKHMMVTRSGAFYHVQVVDGPLVNRHRPSVDVLFRSVAKFAGRNATGIIMTGM
GDDGARGLKEMLDAGSATVAQDEASCVVFGMPKEAIKLNAAQRVMGLQEIAQVILHR