Protein Info for PFR28_02473 in Pseudomonas sp. RS175

Annotation: Protein RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 34 to 51 (18 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 178 to 194 (17 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details TIGR00688: protein RarD" amino acids 3 to 255 (253 residues), 192.2 bits, see alignment E=5.8e-61

Best Hits

Swiss-Prot: 44% identical to RARD_PSEAE: Chloramphenicol-sensitive protein RarD (rarD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 92% identity to pba:PSEBR_a3405)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>PFR28_02473 Protein RarD (Pseudomonas sp. RS175)
MSKGIALSVSASALFAVMYYYTSLLSPLTGLEIFGWRMLLTMPCMTVFMLVAREWHLVTA
LIRRLVATPRLLIAAIASSALMGAQLWLFMWAPLNGYSLDVSLGYFLLPLSMVLTGRIVY
GERLSYLQKVAVFFATLGVFNELYQVGGFSWATLLVVLGYPLYFILRKRTKTHNLGGLWL
DMTLILPLALWFVQSGEQGFEVFNQYPWLSLLIPLLGVISVSALVCYIVASRLLPFSLFG
LLSYVEPVLLLGVALLLGESIKATEWLTYIPIWMAVAVLVFEGFKHLMRQRRRD