Protein Info for PFR28_02442 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details PF01925: TauE" amino acids 6 to 262 (257 residues), 152.7 bits, see alignment E=7e-49

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 82% identity to pfo:Pfl01_3457)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>PFR28_02442 hypothetical protein (Pseudomonas sp. RS175)
MVLAGFSGVIMGVILGLTGAGGGILAVPALVLGLGWSMTQAAPVALLAVGSAAAVGAIDG
LRHGLVRYRAAMLIALLGAVFSPLGIHMAHRLPEKVLMILFGLLMVLVAARMLRGETAQP
GPSDHGAASWGQKNCMLDRQTGRLAWTPRCTVTLSALGAVTGLVSGLLGVGGGFLIVPAF
KQLTDVQMRGIVATSLMVISLISLIGVVGAFHAGVSIDRVGAVFIAASIVGMMLGRRLAA
RVPARVLQVGFAGVCLGVAVFMWVRA