Protein Info for PFR28_02424 in Pseudomonas sp. RS175

Annotation: Inosose dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR04379: myo-inosose-2 dehydratase" amino acids 4 to 290 (287 residues), 382.1 bits, see alignment E=1e-118 PF01261: AP_endonuc_2" amino acids 34 to 289 (256 residues), 103.9 bits, see alignment E=6.2e-34

Best Hits

Swiss-Prot: 48% identical to MOCC_RHIML: Rhizopine catabolism protein MocC (mocC) from Rhizobium meliloti

KEGG orthology group: K03335, inosose dehydratase [EC: 4.2.1.44] (inferred from 97% identity to pba:PSEBR_a3355)

Predicted SEED Role

"Inosose dehydratase (EC 4.2.1.44)" in subsystem Inositol catabolism (EC 4.2.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>PFR28_02424 Inosose dehydratase (Pseudomonas sp. RS175)
MPAIRIGINPISWSNDDLPSLGGETPLSTALSEGKAIGYEGFELNGKFPKDAKGVGDVLR
PYDLALVSGWYSSRLARRSAAEEIDAIASHVELLAQNGATVLVYGEVADSIQGQRIPLIE
RPRFHTDEAWQAYADKLTELARFTLSQGVRLAYHHHMGAYVESPSDIDKLMALTGSEVGL
LFDSGHCYMGGGEPLQVLRKHIERICHVHFKDVRKPVVQLARNNLWSFPDCIINGTFTVP
GDGDIDFAALLDVLLAADYQGWLVVEAEQDPAVAPSYVYAKKGYDTLRALLQERIPA