Protein Info for PFR28_02416 in Pseudomonas sp. RS175

Annotation: Galactose/methyl galactoside import ATP-binding protein MglA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 PF00005: ABC_tran" amino acids 30 to 180 (151 residues), 113.9 bits, see alignment E=9.3e-37 amino acids 280 to 433 (154 residues), 84.4 bits, see alignment E=1.2e-27

Best Hits

Swiss-Prot: 88% identical to RGMG_PSEF5: Putative ribose/galactose/methyl galactoside import ATP-binding protein (PFL_2594) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 96% identity to pba:PSEBR_a3347)

Predicted SEED Role

"Inositol transport system ATP-binding protein" in subsystem Inositol catabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>PFR28_02416 Galactose/methyl galactoside import ATP-binding protein MglA (Pseudomonas sp. RS175)
MTVQPGTLPDEPYLLEVVNVSKGFPGVVALSDVQLRVRPGSVLALMGENGAGKSTLMKII
AGIYQPDAGELRLRGKPVAFDTPLAALQAGIAMIHQELNLMPHMSIAENIWIGREQLNGL
HMIDHGEMHRCTARLLERLRINLDPEEQVGNLSIAERQMVEIAKAVSYDSDILIMDEPTS
AITETEVAHLFSIIADLKSQGKGIIYITHKMNEVFAIADEVAVFRDGAYIGLQRADSMDG
DSLISMMVGRELSQLFPERETPIGEQVLAARDLSLDGVFKGVSFDLHAGEILGIAGLMGS
GRTNVAEAIFGVTPATGGQILLDGQPVRISDPHMAIEKGFALLTEDRKLSGLFPCLSVLE
NMEMAVLPHYVGNGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGNQQKALLARWL
MTNPRILILDEPTRGIDVGAKAEIYRLIAFLASEGMAVIMISSELPEVLGMSDRVLVMHE
GDQMGILDRSEATQERVMQLASGLSAVH