Protein Info for PFR28_02377 in Pseudomonas sp. RS175

Annotation: Serine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 345 to 362 (18 residues), see Phobius details amino acids 367 to 391 (25 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details TIGR00814: serine transporter" amino acids 23 to 414 (392 residues), 537 bits, see alignment E=1.5e-165 PF03222: Trp_Tyr_perm" amino acids 35 to 417 (383 residues), 46.5 bits, see alignment E=1.5e-16

Best Hits

Swiss-Prot: 67% identical to SDAC_ECOLI: Serine transporter (sdaC) from Escherichia coli (strain K12)

KEGG orthology group: K03837, serine transporter (inferred from 96% identity to pba:PSEBR_a3309)

MetaCyc: 67% identical to L-serine:H+ symporter SdaC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>PFR28_02377 Serine transporter (Pseudomonas sp. RS175)
MNDQANSVEERFEATAPATLSQWSRHDTTWMLGLFGTAIGAGTLFLPINAGLGGFWPLLI
LALLAFPMTFYAHRGLTRFVLSGRDGADITEVVEEHFGIKAGALITLLYFFAIFPILLIY
SVALTNTVGSFLEHQLHIQPPPRAVLSLVLILGLLAVVRCGEQAIVKAMSLMVYPFIVAL
LFLAVFLIPHWNGGILTTASTLPEPSALLHTLWLAIPVMVFSFNHSPIISAFAVDQKRRY
GVNAQARSSQILSRAHVLMVVMVLFFVFSCVLTLSPAQLAEAKAQNLSILSYLANHFSNR
TIAFAAPLIAFVAISKSFLGHYIGASEGLKGLIVKSGRRPAPKTLDRLTAMFMLVVCWIV
ATLNPSILGMIETLGGPVIAAILFLMPMYAIQKVPAMARYRGQASNVFVTLVGVVAITAL
VYSLTS