Protein Info for PFR28_02357 in Pseudomonas sp. RS175

Annotation: Bicyclomycin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 36 to 59 (24 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details PF06609: TRI12" amino acids 27 to 205 (179 residues), 25.6 bits, see alignment E=8.7e-10 TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 33 to 412 (380 residues), 216 bits, see alignment E=5.9e-68 PF07690: MFS_1" amino acids 41 to 380 (340 residues), 160.6 bits, see alignment E=1e-50 PF00083: Sugar_tr" amino acids 69 to 204 (136 residues), 36.9 bits, see alignment E=4.2e-13 PF13347: MFS_2" amino acids 164 to 353 (190 residues), 28.2 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 74% identity to pba:PSEBR_a2280)

Predicted SEED Role

"multidrug resistance transporter, Bcr/CflA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>PFR28_02357 Bicyclomycin resistance protein (Pseudomonas sp. RS175)
MMAEPRTPSLQPAEGGTAGTLVASSAPGQPILSARIVVLLAGLAAISILSTNIILPAFAD
IGQELGVPTRALGLTLSSFFITFALAQLIVGPLADRYGRKKLVLGGLSLFVAGTAVAGFA
TTLETLLLGRIIQALGVCAAAVLSRAIARDLFEGENLARALSLTMIATAAAPGFSPLIGS
LLTSTLGWRAIFALVALAAIAIAIFYARGLGETHPPERRAPHSPLSVLRAYGGLLRDRRF
VLPAVSVSLLMSGLFASFGAAPAILMSGIGLTSLEAGLYFAATVFVVFAAGMAAPHLARR
YGSRKITALGFATALAGGLVLIVGPADPGLAWYSLSMVIFLWGMGLANPLGTAITLNPFG
KEAGLASALLGFLTMGASAVTTWLGSASDFAPVTTLGVTQASVCLVAIILFLFTHRT