Protein Info for PFR28_02326 in Pseudomonas sp. RS175

Annotation: putative oxidoreductase CzcO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF13738: Pyr_redox_3" amino acids 39 to 165 (127 residues), 66.1 bits, see alignment E=6.9e-22 PF07992: Pyr_redox_2" amino acids 61 to 288 (228 residues), 33.5 bits, see alignment E=6.4e-12 PF13434: Lys_Orn_oxgnase" amino acids 77 to 156 (80 residues), 31.3 bits, see alignment E=2.4e-11 PF00743: FMO-like" amino acids 93 to 159 (67 residues), 41 bits, see alignment E=1.9e-14

Best Hits

KEGG orthology group: None (inferred from 84% identity to pba:PSEBR_a2507)

MetaCyc: 61% identical to [arsenate oxidoreductase]-[AioE protein] oxidoreductase (Agrobacterium tumefaciens GW4)
1.20.98.-

Predicted SEED Role

"monooxygenase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>PFR28_02326 putative oxidoreductase CzcO (Pseudomonas sp. RS175)
MLDAQEGPGGAWRHGWNSLRLFSPATWSSLPGWMMPPTQDGYPSRNHVIDYLDRYEQRYG
LEVVRPVRVTAVERIQGGLRVSAADRQWEARVVVSATGTWSNPYIPRYPDAALFAGQQLH
SAHYVEARPFAGKNVLVVGGGNSGAQILAEVSRVARTTWVTPQAPLFLPDEVDGRVLFER
ATERWKAQQQGRVINQPVGGLGDIVMVPPVVEARERGVLQSVRPFERFSRNGVIWANGSE
SLVDVVIWCTGFRPALQHLETLVPIDREGRVEVQGTRSIQEPRLWLVGYGEWTGSASATL
IGVTRTARSTASEIAAFLSAHPTDNGPG