Protein Info for PFR28_02296 in Pseudomonas sp. RS175

Annotation: Tryptophan-rich sensory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details PF03073: TspO_MBR" amino acids 7 to 142 (136 residues), 130.3 bits, see alignment E=2.3e-42

Best Hits

Swiss-Prot: 49% identical to CRTK_RHOCB: Protein CrtK (crtK) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K07185, tryptophan-rich sensory protein (inferred from 88% identity to pfs:PFLU4225)

Predicted SEED Role

"TspO/MBR family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>PFR28_02296 Tryptophan-rich sensory protein (Pseudomonas sp. RS175)
MTFFIFLLACCAAASTGVIFKPGQWYESLVKPRFTPPNWLFPVAWTVIYLLLAWAGYRLS
MIPGSQQALALWAAQIALNTLWTPVFFGAHQVLAGMVVIALLWLVVAAMVVLALRLDVIT
GLILFPYLAWLCVAATLNFSILRNNR