Protein Info for PFR28_02250 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 135 to 160 (26 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details PF01810: LysE" amino acids 10 to 187 (178 residues), 30 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: None (inferred from 57% identity to psb:Psyr_2604)

Predicted SEED Role

"FIG00957335: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>PFR28_02250 hypothetical protein (Pseudomonas sp. RS175)
MSYIALSLMTVLLVPGPTNSLLLQTGINRGLNARSMRFVVAEWLAYIVQMTMWGVFIDLL
ITDHSWVVIATKIFAVCFLFYISLKLWFSVKDHLPGTSAGISVPDLFVATLTNPKGLFFV
SFVAPAGTFLSVSHYLSFMSLFTAIIFPVGLTWIAIGAFCGRKLHAIVSGKFLSRAISLV
IGLFACGMLFNIASQVGFA