Protein Info for PFR28_02243 in Pseudomonas sp. RS175

Annotation: putative ABC transporter ATP-binding protein NosF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00005: ABC_tran" amino acids 19 to 156 (138 residues), 103.9 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 70% identical to NOSF_PSEST: Probable ABC transporter ATP-binding protein NosF (nosF) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 89% identity to pba:PSEBR_a2646)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosF (ATPase)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>PFR28_02243 putative ABC transporter ATP-binding protein NosF (Pseudomonas sp. RS175)
MNVVEIEGVSQRYGDATVLHGLDLDLAQGEVLGLFGHNGAGKTTTMKLVLGLLRASEGQV
RVFGRAPSDPSVRQMLGYLPENVMFYPQLSGLETLRHFARLKGAAPGQVERLLEEVGLSQ
ASRRKVRTYSKGMRQRLGLAQALLGRPRLLLLDEPTVGLDPIATQDLYQLLDRLRWQGTS
IILCSHVLPGVETHINRAAILTRGRLLALGSLARLREEARLPTLIRASGLARASQLQQHW
RSEGHVTQGWGAEGLQVAAPDGSKLALLRQLLAQHNPTDVEIKPPSLEDLYRHYMSGAAA
GEVRP