Protein Info for PFR28_02226 in Pseudomonas sp. RS175

Annotation: Nitric oxide reductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF00034: Cytochrom_C" amino acids 51 to 132 (82 residues), 48.3 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 82% identical to NORC_PSEST: Nitric oxide reductase subunit C (norC) from Pseudomonas stutzeri

KEGG orthology group: K02305, nitric oxide reductase, cytochrome c-containing subunit II (inferred from 94% identity to pba:PSEBR_a3168)

MetaCyc: 82% identical to nitric-oxide reductase small subunit (Stutzerimonas stutzeri)
NITRIC-OXIDE-REDUCTASE-RXN [EC: 1.7.2.5]

Predicted SEED Role

"Nitric-oxide reductase subunit C (EC 1.7.99.7)" in subsystem Denitrification (EC 1.7.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.5, 1.7.99.7

Use Curated BLAST to search for 1.7.2.5 or 1.7.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>PFR28_02226 Nitric oxide reductase subunit C (Pseudomonas sp. RS175)
MSDTFTKGMARNIYFGGSIFFFLIFLALTYHTEQTFPDRSNQAQLSESVIRGKGVWERNN
CIGCHTLLGEGAYFAPELGNVINRRGGEEAFKPFLQAWMKMQPLGAPGRRAMPQFNLSEQ
EVDDLGEFLKWSSKINTNGWPPNKEG