Protein Info for PFR28_02162 in Pseudomonas sp. RS175

Annotation: Multidrug resistance protein Stp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 54 to 71 (18 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 407 to 434 (28 residues), see Phobius details amino acids 443 to 467 (25 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 422 (403 residues), 137 bits, see alignment E=3.8e-44

Best Hits

KEGG orthology group: None (inferred from 75% identity to pfo:Pfl01_2726)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>PFR28_02162 Multidrug resistance protein Stp (Pseudomonas sp. RS175)
MPREKVALAEPRRWLMFAILLVGAFLPPLDFFIVNVALPSIQESLGTASSAEQLVISSYA
ALYAVTLITGGRLGDIYGRMRMFFVGLVGFAVASLVCGVADSPWVLIAGRSLQGVTAAVM
APQALASVQAIFPESEKPLALSLYGAVFGLASVVGQALGGILISLNLMGLGWRAIFLVNL
PIAVLIILVAIAVVKETRAPHTSKLDLGGTALSMVTLGALIVPLIEGREAGWPLWTWLSL
AAVPLLAWLFWRYETRLHQAQGAPLLNPAALRTPGLGRALLVALTFYAIGVFFLLFSIYL
QGALHMSPLDAGLVFLPFGAGFLLGPLSTNRFRRFLGAYVNPVGMGLEVLGFVLLAWLVV
RTPMTVSPTALPLAVILFVIGFGQGLALPTLMRMITGRVAPAYSGMIAGITSSTLQISTS
LSVAIIGGIFYTLLGTDTDAAAITHAFTVSILCIAVCLAAGAALSLGLARQPAAGLQTAA
MRPAE