Protein Info for PFR28_02107 in Pseudomonas sp. RS175

Annotation: Putative glutamate--cysteine ligase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 146 to 164 (19 residues), see Phobius details TIGR02050: carboxylate-amine ligase, YbdK family" amino acids 7 to 291 (285 residues), 316.3 bits, see alignment E=9.4e-99 PF04107: GCS2" amino acids 7 to 285 (279 residues), 211.1 bits, see alignment E=1.2e-66

Best Hits

Swiss-Prot: 53% identical to GCS2_PSEF5: Putative glutamate--cysteine ligase 2 (PFL_4726) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 87% identity to pba:PSEBR_a2837)

Predicted SEED Role

"Carboxylate-amine ligase bll3764 (EC 6.3.-.-)" (EC 6.3.-.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>PFR28_02107 Putative glutamate--cysteine ligase 2 (Pseudomonas sp. RS175)
MNRRLKFGIEEEYFLTDLQTRSMPGQPSAAAVAACRTELGKHFAHEMFQSQIEMASPIFR
SLPEAADFLAQVRAGLTQRLAPYGLGLLSAGSHPMATQDLQPTDELHFQQLFDDYQRVAR
RSVLSGLHVHVEVPADRDRVKVMNEVLPWLPMFLALSASSPFWNGAYSGFSSYRQVACDE
WPRMGVPEYFENESAFASYVDLLMRTGSIRQASDCWWVIRPSSRYPTLELRICDACPRVE
DVLCLVSLFRLMVAHAAAQPKPGARYSQMSQWILKENRLRAKRHGILAEFIIEGQEQPVL
IGEWLTMAEQTFGDTAAALGVQDVFKQARRIVQEGTSADRQVVLYEQGLLLGDSIEQALG
RVVDQLLSETAGLPVASPQLPQAAGA