Protein Info for PFR28_02105 in Pseudomonas sp. RS175

Annotation: Inner membrane protein YohC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 30 to 54 (25 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 190 (27 residues), see Phobius details PF04893: Yip1" amino acids 7 to 181 (175 residues), 125.6 bits, see alignment E=9.9e-41

Best Hits

Swiss-Prot: 42% identical to YOHC_ECOL6: Inner membrane protein YohC (yohC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 85% identity to pba:PSEBR_a2839)

Predicted SEED Role

"probable membrane protein YPO2362"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>PFR28_02105 Inner membrane protein YohC (Pseudomonas sp. RS175)
MSAPLVKLFTHPEFAWKDIREQEQAHPSHYLGHLLLLALIPTVCLFIGTTWTGWSLAENE
TVRLNSASALQLCVLLYLTIVAGVVLMGAFIRWMSRTFEARPTLNQCIGFAAYTATPYFL
AGLMGLYPNRWLAAIVLLAASAYATFLLFVGLPRFMNLKKEQGLLYSASVWGVGLLVLVT
ILVEMILFWFNVLQPEYLRFPAG